Logo
Alpher Online
 Current page : Home

301 Moved Permanently

Moved Permanently

The document has moved here.


Apache Server at killexams.com Port 80
Killexams 920-174 Dumps | Lastest Killexams 920-174 dumps and questions answers - alphernet.com.au

920-174 | Nortel Contact Center Manager Rls. 7.0(R) Install and Config

Updated 920-174 Practice Test @ Killexams

VCE Practice Tests provided Here   |   View Blog Article Home

920-174 - Nortel Contact Center Manager Rls. 7.0(R) Install and Config - braindump

Vendor Nortel
Exam Number 920-174
Exam Name Nortel Contact Center Manager Rls. 7.0(R) Install and Config
Questions 55 Q & A
Updated On Click to Check Update
Free PDF Download 920-174 Brain Dump
Download Full Braindumps PDF Killexams 920-174 Complete Document


killexams free 920-174 Brain Dumps with Real Questions


Web is full of 920-174 braindumps providers but most of them are selling outdated and invalid dumps. You have to search the valid and up-to-date 920-174 brain dumps provider on the web. If you do not want to waste your time on searching, visit killexams.com rather than spending hundreds of dollars on invalid and obsolete contents. We suggest you to download killexams 100% free 920-174 sample questions and read. When you get satisfaction with the quality of questions, register for 3 months account to download latest and valid 920-174 dumps that contains real 920-174 exam questions. Practice with 920-174 VCE practice test repeatedly until you learn all the questions bit by bit. Features of Killexams 920-174 dumps -> Instant 920-174 Dumps download Access -> Comprehensive 920-174 Questions and Answers -> 98% Success Rate of 920-174 Exam -> Guaranteed Real 920-174 exam Questions -> 920-174 Questions Updated on Regular basis. -> Valid 920-174 Exam Dumps -> 100% Portable 920-174 Exam Files -> Full featured 920-174 VCE Exam Simulator -> Unlimited 920-174 Exam Download Access -> Great Discount Coupons -> 100% Secured Download Account -> 100% Confidentiality Ensured -> 100% Success Guarantee -> 100% Free Dumps Questions for evaluation -> No Hidden Cost -> No Monthly Charges -> No Automatic Account Renewal -> 920-174 Exam Update Intimation by Email -> Free Technical Support Exam Detail at : https://killexams.com/pass4sure/exam-detail/920-174 Pricing Details at : https://killexams.com/exam-price-comparison/920-174 See Complete List : https://killexams.com/vendors-exam-list Discount Coupon on Full 920-174 Dumps Question Bank; WC2017: 60% Flat Discount on each exam PROF17: 10% Further Discount on Value Greatr than $69 DEAL17: 15% Further Discount on Value Greater than $99


920-174 dumps, 920-174 braindumps, 920-174 Questions and Answers, 920-174 Practice Test, 920-174 Real Questions, Pass4sure 920-174, Pass4sure 920-174 Practice Test, Download 920-174 dumps, Free 920-174 pdf, 920-174 Dumps Free, 920-174 practice exam, 920-174 actual test, 920-174 PDF download, Pass4sure 920-174 Download, 920-174 VCE


View Full Exam »

Customer Reviews about 920-174

920-174 - Nortel Contact Center Manager Rls. 7.0(R) Install and Config - Reviews

Our customers are always happy to give their reviews about the exams. Most of them are our permanent users. They do not rely on others except our team and they get exam confidence by using our questions and answers and exam simulator.

Real 920-174 questions and accurate answers! It justify the payment.

I answered all questions in only 1/2 time in my 920-174 exam. I can have the capability to make use of the Killexams observe guide purpose for different tests as correctly. much liked Killexams brain dump for the assistance. I need to tell that together along with your out of the ordinary observe and honing devices; I passed my 920-174 exam with suitablemarks. This due to the homework cooperates with your application.

it's miles proper source to find 920-174 real exam questions paper.

I am confident to recommend Killexams 920-174 questions answers and exam simulator to everyone who prepares to take their 920-174 exam. This is the most updated preparation info for the 920-174 available online as it really covers complete 920-174 exam, This one is really good, which I can vouch for as I passed this 920-174 exam last week. Questions are updated and correct, so I did not have any trouble during the exam and got good marks and I highly recommend Killexams

What a outstanding source of 920-174 questions that paintings in actual check.

The exam material of 920-174 exam is outlined nicely for get geared up inside a short time period. Killexams questions and answers made me score 88% with answering all questions 90 mins of time. The exam paper 920-174 has diverse test material in commercial enterprise region. Yet it were given to be tremendously troublesome for me to choose the Great one. Be that as it could after my brother requested that I used Killexams Questions and answers, I did not observe for different books. a great deal obliged for assisting me.

real exam questions of 920-174 exam! Awesome Source.

I passed the exam with a fulfilling eighty four% marks in stipulated time. Thank you very a super deal Killexams. Through and thru, it have become hard to do pinnacle to backside test intending with a complete-time work. At that factor, I grew to turn out to be to the Questions and Answers of Killexams. Its concise answers helped me to look some elaborate topics. I decided on to sit down down for the exam 920-174 to benefit further development in my profession.

Can you believe, all 920-174 questions I prepared were asked.

I am happy to inform that I have easily handed the 920-174 exam. on this context I should admit that your questions bankdid help (if now not completely) to tied over the exam as the questions requested in the exam were no longer fullyblanketed via your questions and answers. but I must congratulate your attempt to make us technically sound with your Questions and Answers. way to Killexams for passing my 920-174 exam in first class.

That became outstanding! I got actual test questions of 920-174 examination.

Like many others, I have recently passed the 920-174 exam. In my case, vast majority of 920-174 exam questions came exactly from this guide. The answers are correct, too, so if you are preparing to take your 920-174 exam, you can fully rely on this website.

Dont forget to try these dumps questions for 920-174 examination.

Learning for the 920-174 exam has been a tough going. With so many confusing topics to cover, Killexams induced the confidence for passing the exam by taking me through core questions on the subject. It paid off as I could pass the exam with a good pass% of 84%. A few of the questions came twisted, but the answers that matched from Killexams helped me mark the right answers.

Do you need Latest dumps of 920-174 exam to pass the exam?

Iused to be trapped in the complex subjects less than 12 earlier days the exam 920-174. Whats greater it becomeextremely useful, as the quick answers will be easily remembered inside 10 days. I scored 91%, endeavoring all questions in due time. To store my planning, I was energetically looking down a few speedy reference. It aided me a top notch deal. by no means thought it can be so compelling! At that point, by means of one method or some other I came to consider Killexams Dumps.

Do you need Actual test questions of 920-174 exam to prepare?

To get fulfillment in 920-174 exam. Humans agree with that a pupil have to personal sharp thoughts. Even though it is right but it isnt definitely real because of the fact that along with the pupil, the educate or the teacher ought to also be nicely qualified and informed. I sense blessed that I was acquainted with Killexams in which I met such wonderful educators who taught me a way to pass my 920-174 exam and had been given me through them with a breeze. I thank them with the bottom of my coronary heart.

what is easiest manner to bypass 920-174 examination?

Iam one some of the high achiever inside the 920-174 exam. What a super Questions and Answers material they supplied. within a short time I grasped the entirety on all of the applicable topics. It become Truely tremendous! I suffered a lot whilst making ready for my preceding attempt, however this time I passed my exam very without problems without tension and concerns. Its virtually admirable learning journey for me. Thank you a lot Killexams for the real help.

Review Complete Testimonials »

See more Nortel exam dumps

Direct Downloads Here

Real Exam Questions and Answers of exams

We offer a huge collection of Nortel exam questions and answers, study guides, practice exams, Exam Simulator.

920-345 Sample exam | 920-128 dumps pdf | 920-174 dumps pdf | 920-110 Quiz | 920-324 cheat sheet pdf | 920-258 examcollection | 920-180 exam questions & answers | 920-221 examsking | 920-462 examcollection | 920-115 dumps | 920-453 exam cost | 920-352 getfreedumps | 920-138 exam fee | 920-332 questions and answers pdf | 920-333 passguide | 920-530 free download | 920-470 elearningexams | 922-089 ebook download | 920-259 trainsignal | 920-178 Question Answer Bank | 920-331 | 920-320 practice quiz | 920-325 training tools | 920-195 updated questions | 920-456 boson practice | 920-432 free pdf | 920-196 pdf study guide | 920-330 objectives | 920-334 made easy | 920-132 vce exam simulator | 920-537 cheat sheets | 920-245 exam leader | 920-548 study | 920-327 flashcards pdf | 920-804 questions & answers with explanations | 920-123 answers | 920-172 studies | 920-505 guide | 922-101 questions & answers | 920-160 MCQ | 920-316 exam dumps | 920-220 killtest | 920-451 free e-book | 920-136 study guide pdf | 920-471 Sample Study guide | 920-270 number of questions | 920-234 Question Bank | 920-257 test prep online | 920-362 free answers | 920-106 official cert guide library pdf |

View Complete Nortel Collection »

Latest Exams added

 

Latest Practice Exam Questions and Answers Added to Killexams.com

We keep our visitors and customers updated regarding the latest technology certifications by providing reliable and authentic exam preparation material. Our team remain busy in updating 920-174 exam training material as well as reviewing the real exam changes. They try best to provide each and every relevant information about the test for the candidate to get good marks and come out of test center happily.

010-160 | 156-315-80 | 1Z0-1005 | 1Z0-1010 | 1Z0-1011 | 1Z0-1012 | 1Z0-1013 | 1Z0-930 | 1Z0-956 | 1Z0-975 | 2V0-01-19 | 2V0-51-18 | 2V0-602PSE | 5V0-31-19 | ATM | ATTA | C1000-016 | DES-1B21 | E20-893 | HP2-H78 | HP2-H80 | HP2-H84 | HPE2-W02 | JN0-220 | MS-101 | MS-202 | NS0-300 | PEGACSA74V1 | PEGACSSA72V1 | TTA1 | 156-115.80 | 1Z0-074 | 1Z0-1000 | 1Z0-1009 | 1Z0-1014 | 1Z0-1015 | 1Z0-1016 | 1Z0-1017 | 1Z0-1018 | 1Z0-1019 | 1Z0-1021 | 1Z0-1024 | 1Z0-1026 | 1Z0-1028 | 1Z0-888 | 1Z0-926 | 1Z0-972 | 1Z0-993 | 220-010 | 220-1001 | 220-1002 | 250-437 | 2V0-01.19 | 2V0-51.18 | 2V0-622PSE | 312-50v10 | 3V0-732 | 3V0-752 | 500-470 | 500-901 | 71200X | 72200X | 7392X | 7492X | 7495X | AWS-CANS | AWS-CSAA-2019 | AWS-CSAA | AWS-CSAP | AWS-CSS | AZ-203 | AZ-302 | AZ-400 | AZ-900 | C2090-101 | C2150-610 | CAU302 | CCE-CCC | CWAP-403 | DEA-2TT3 | DEE-1421 | DES-4121 | DP-100 | FC0-U61 | Google-PCA | H12-222 | H12-223 | H12-311 | H12-711 | H13-511 | H13-611 | H13-612 | H13-629 | H31-211 | H31-523 | HPE0-J58 | JN0-1101 | MA0-107 | MAC-16A | MD-100 | MD-101 | MS-100 | MS-200 | MS-201 | MS-300 | MS-301 | MS-302 | NSE5_FAZ-6-0 | NSE8-810 | PRINCE2-Re-Registration | SVC-16A | 156-727-77 | 1Z0-936 | 1Z0-980 | 1Z0-992 | 250-441 | 3312 | 3313 | 3314 | 3V00290A | 7497X | AZ-302 | C1000-031 | CAU301 | CCSP | DEA-41T1 | DEA-64T1 | HPE0-J55 | HPE6-A07 | JN0-1301 | PCAP-31-02 | 1Y0-340 | 1Z0-324 | 1Z0-344 | 1Z0-346 | 1Z0-813 | 1Z0-900 | 1Z0-935 | 1Z0-950 | 1Z0-967 | 1Z0-973 | 1Z0-987 | A2040-404 | A2040-918 | AZ-101 | AZ-102 | AZ-200 | AZ-300 | AZ-301 | FortiSandbox | HP2-H65 | HP2-H67 | HPE0-J57 | HPE6-A47 | JN0-662 | MB6-898 | ML0-320 | NS0-159 | NS0-181 | NS0-513 | PEGACPBA73V1 | 1Z0-628 | 1Z0-934 | 1Z0-974 | 1Z0-986 | 202-450 | 500-325 | 70-537 | 70-703 | 98-383 | 9A0-411 | AZ-100 | C2010-530 | C2210-422 | C5050-380 | C9550-413 | C9560-517 | CV0-002 | DES-1721 | MB2-719 | PT0-001 | CPA-REG | CPA-AUD | AACN-CMC | AAMA-CMA | ABEM-EMC | ACF-CCP | ACNP | ACSM-GEI | AEMT | AHIMA-CCS | ANCC-CVNC | ANCC-MSN | ANP-BC | APMLE | AXELOS-MSP | BCNS-CNS | BMAT | CCI | CCN | CCP | CDCA-ADEX | CDM | CFSW | CGRN | CNSC | COMLEX-USA | CPCE | CPM | CRNE | CVPM | DAT | DHORT | CBCP | DSST-HRM | DTR | ESPA-EST | FNS | FSMC | GPTS | IBCLC | IFSEA-CFM | LCAC | LCDC | MHAP | MSNCB | NAPLEX | NBCC-NCC | NBDE-I | NBDE-II | NCCT-ICS | NCCT-TSC | NCEES-FE | NCEES-PE | NCIDQ-CID | NCMA-CMA | NCPT | NE-BC | NNAAP-NA | NRA-FPM | NREMT-NRP | NREMT-PTE | NSCA-CPT | OCS | PACE | PANRE | PCCE | PCCN | PET | RDN | TEAS-N | VACC | WHNP | WPT-R | 156-215-80 | 1D0-621 | 1Y0-402 | 1Z0-545 | 1Z0-581 | 1Z0-853 | 250-430 | 2V0-761 | 700-551 | 700-901 | 7765X | A2040-910 | A2040-921 | C2010-825 | C2070-582 | C5050-384 | CDCS-001 | CFR-210 | NBSTSA-CST | E20-575 | HCE-5420 | HP2-H62 | HPE6-A42 | HQT-4210 | IAHCSMM-CRCST | LEED-GA | MB2-877 | MBLEX | NCIDQ | VCS-316 | 156-915-80 | 1Z0-414 | 1Z0-439 | 1Z0-447 | 1Z0-968 | 300-100 | 3V0-624 | 500-301 | 500-551 | 70-745 | 70-779 | 700-020 | 700-265 | 810-440 | 98-381 | 98-382 | 9A0-410 | CAS-003 | E20-585 | HCE-5710 | HPE2-K42 | HPE2-K43 | HPE2-K44 | HPE2-T34 | MB6-896 | VCS-256 | 1V0-701 | 1Z0-932 | 201-450 | 2VB-602 | 500-651 | 500-701 | 70-705 | 7391X | 7491X | BCB-Analyst | C2090-320 | C2150-609 | IIAP-CAP | CAT-340 | CCC | CPAT | CPFA | APA-CPP | CPT | CSWIP | Firefighter | FTCE | HPE0-J78 | HPE0-S52 | HPE2-E55 | HPE2-E69 | ITEC-Massage | JN0-210 | MB6-897 | N10-007 | PCNSE | VCS-274 | VCS-275 | VCS-413 |

View Complete List »

See more braindumps

 

Actual Test Questions and Answers of exams

You should visit the actual questions and braindumps website that provide 100% free dumps for you to review and make your decision to buy full version of exam.

Read more Details »

Top of the list Vendors

 

Industry Leading Vendors

Top notch vendors that dominate the entire world market by their technology and experties. We try to cover almost all the technology vendors and their certification areas so that our customers and visitors obtain all the information about test at one place.

View Complete List »

920-174 Sample Questions

 

920-174 Demo and Sample

Note: Answers are below each question.
Samples are taken from full version.

Killexams 920-174 dumps | 920-174 Real test Questions | [HOSTED-SITE]




Valid and Updated 920-174 Dumps | Real Questions 2019

100% valid 920-174 Real Questions - Updated on daily basis - 100% Pass Guarantee



920-174 test Dumps Source : Download 100% Free 920-174 Dumps PDF

Test Number : 920-174
Test Name : Nortel Contact Center Manager Rls. 7.0(R) Install and Config
Vendor Name : Nortel
Q&A : 55 Dumps Questions

Click and download 920-174 test braindumps and VCE files
If you want to pass Nortel 920-174 exam, killexams.com has created Nortel real test questions database that will certain you pass 920-174 exam! killexams.com provides you the valid, latest and updated 920-174 dumps questions and provided with a 100% Guarantee.

Lot of people download free 920-174 dumps PDF from internet and do great struggle to memorize those outdated questions. They try to save little braindumps fee and risk entire time and test fee. Most of those people fail their 920-174 exam. This is just because, they spent time on outdated questions and answers. 920-174 test course, objectives and Topics remain changing by Nortel. That's why continuous braindumps update is required otherwise, you will see entirely different questions and answers at test screen. That is a big drawback of free PDF on internet. Moreover, you can not practice those questions with any test simulator. You just waste lot of resources on outdated material. We suggest in such case, go through killexams.com to download free PDF dumps before you buy. Review and see the changes in the test topics. Then decide to register for full version of 920-174 dumps. You will surprise when you will see all the questions on real test screen.

Features of Killexams 920-174 dumps
-> Instant 920-174 Dumps download Access
-> Comprehensive 920-174 Questions and Answers
-> 98% Success Rate of 920-174 Exam
-> Guaranteed Real 920-174 test Questions
-> 920-174 Questions Updated on Regular basis.
-> Valid 920-174 test Dumps
-> 100% Portable 920-174 test Files
-> Full featured 920-174 VCE test Simulator
-> Unlimited 920-174 test download Access
-> Great Discount Coupons
-> 100% Secured download Account
-> 100% Confidentiality Ensured
-> 100% Success Guarantee
-> 100% Free Dumps Questions for evaluation
-> No Hidden Cost
-> No Monthly Charges
-> No Automatic Account Renewal
-> 920-174 test Update Intimation by Email
-> Free Technical Support

Discount Coupon on Full 920-174 Dumps Question Bank;
WC2017: 60% Flat Discount on each exam
PROF17: 10% Further Discount on Value Greatr than $69
DEAL17: 15% Further Discount on Value Greater than $99



Killexams 920-174 Customer Reviews and Testimonials


I want real test questions latest 920-174 exam.
It was in fact very beneficial. Your accurate questions and answers helped me clean 920-174 in first try with 78.75% marks. My marks was 90% however because of terrible marking it got here to 78.Seventy five%. Incredible pastime killexams.com crew..May additionally you obtain all of the success. Thank you.


Get cost percent of expertise to put together 920-174 exam.
Eventually, at the dinner desk, my father requested me right now if I used to be going to fail my upcoming 920-174 test and that I answered with a very employer No way. He grow to be inspired with my self assurance but I was so frightened of disappointing him. Thank God for killexams.com as it helped me in maintaining my phrase and passing my 920-174 test with quality outcomes. I am thankful.


Take Advantage of 920-174 braindumps, Use these questions to ensure your success.
I became about to surrender test 920-174 because I was not assured in whether or not I could pass or no longer. With just a week last I decided to exchange to killexams.com braindumps for my test preparation. Never concept that the subjects that I had always run away from will be so much fun to observe; its clean and brief way of getting to the factors made my practice lot less complicated. All thanks to killexams.com Questions and Answers, I never expected I could pass my test but I did pass with flying shades.


Located an accurate source for real 920-174 Questions.
The standard of killexams.com is high enough to help the candidates in 920-174 test training. All the products that I had used for 920-174 test preparation were of the best quality so they assisted me to pass the 920-174 test shortly.


Had been given no problem! 3 days education 920-174 brain dumps is needed.
I prepared 920-174 with the help of killexams.com and found that they have pretty good stuff. I will go for other Nortel exams as well.


Nortel Contact Center Manager Rls. 7.0(R) Install and Config book

can not open cyber web explorer or any programs, anybody I try says it's infected. | 920-174 Dumps and Real test Questions with VCE Practice Test

Malware Bytes log

Malwarebytes' Anti-Malware 1.50.1.1100www.malwarebytes.org

Database edition: 5561

home windows 5.1.2600 provider Pack 3Internet Explorer 7.0.5730.11

1/20/2011 1:19:02 PMmbam-log-2011-01-20 (13-19-02).txt

Scan type: Full scan (C:\|)Objects scanned: 298301Time elapsed: 1 hour(s), 33 minute(s), fifty three second(s)

reminiscence techniques infected: 0Memory Modules contaminated: 0Registry Keys infected: 1Registry Values contaminated: 2Registry statistics items infected: 0Folders contaminated: 0Files infected: 0

memory procedures contaminated:(No malicious items detected)

reminiscence Modules infected:(No malicious objects detected)

Registry Keys contaminated:HKEY_CURRENT_USER\utility\yr87fk3d2dnszapq2 (Trojan.FakeAlert) -> Quarantined and deleted efficiently.

Registry Values contaminated:HKEY_CURRENT_USER\application\Microsoft\windows\CurrentVersion\Run\rthghtoh (Trojan.FakeAlert.Gen) -> price: rthghtoh -> Quarantined and deleted efficaciously.HKEY_CURRENT_USER\software\Microsoft\home windows\CurrentVersion\Run\toovadvj (Trojan.FakeAlert.Gen) -> cost: toovadvj -> Quarantined and deleted correctly.

Registry records objects contaminated:(No malicious items detected)

Folders infected:(No malicious gadgets detected)

files infected:(No malicious items detected)

DDS

DDS (Ver_09-12-01.01) - NTFSx86Run by HP_Administrator at 13:20:30.65 on Thu 01/20/2011Internet Explorer: 7.0.5730.11Microsoft windows XP knowledgeable 5.1.2600.3.1252.1.1033.18.958.355 [GMT -8:00]

AV: AVG Anti-Virus Free *On-entry scanning enabled* (up-to-date) 17DDD097-36FF-435F-9E1B-52D74245D6BF

============== running processes ===============

C:\home windows\system32\Ati2evxx.exeC:\home windows\system32\svchost -okay DcomLaunchsvchost.exeC:\home windows\System32\svchost.exe -okay netsvcssvchost.exesvchost.exeC:\software files\AVG\AVG9\avgchsvx.exeC:\program data\AVG\AVG9\avgrsx.exeC:\windows\system32\spoolsv.exeC:\application files\AVG\AVG9\avgcsrvx.exeC:\windows\system32\Ati2evxx.exeC:\windows\Explorer.EXEsvchost.exeC:\program information\general data\ArcSoft\Connection carrier\Bin\ACService.exeC:\application files\typical data\Apple\cellular machine help\AppleMobileDeviceService.exeC:\program files\AVG\AVG9\avgwdsvc.exeC:\program info\Bonjour\mDNSResponder.exeC:\windows\eHome\ehRecvr.exeC:\home windows\eHome\ehSched.exeC:\windows\System32\svchost.exe -okay HTTPFilterC:\program files\Verizon\IHA_MessageCenter\Bin\Verizon_IHAMessageCenter.exeC:\HP\KBD\KBD.EXEC:\software files\AVG\AVG9\avgnsx.exeC:\windows\ehome\ehtray.exeC:\application files\HTC\HTC Sync\software Launcher\software Launcher.exeC:\program information\Verizon\McciTrayApp.exeC:\program information\Verizon\VSP\VerizonServicepoint.exeC:\program information\Java\jre6\bin\jqs.exeC:\program files\LeapFrog\LeapFrog connect\monitor.exeC:\windows\system32\ctfmon.exeC:\program data\Google\GoogleToolbarNotifier\GoogleToolbarNotifier.exeC:\application information\windows Media player\WMPNSCFG.exeC:\software files\LeapFrog\LeapFrog join\CommandService.exeC:\documents and Settings\HP_Administrator\native Settings\utility statistics\Google\replace\1.2.183.39\GoogleCrashHandler.exeC:\program info\commonplace data\LightScribe\LSSrvc.exeC:\application files\common data\LogiShrd\LVCOMSER\LVComSer.exeC:\application information\typical information\LogiShrd\LVMVFM\LVPrcSrv.exeC:\program info\ordinary info\Teleca Shared\logger.exeC:\program files\HP\Digital Imaging\bin\hpqtra08.exeC:\program data\ordinary info\cause\McciCMService.exeC:\application data\commonplace information\Microsoft Shared\VS7DEBUG\MDM.EXEC:\application information\Updates from HP\9972322\application\Updates from HP.exeC:\windows\system32\PnkBstrA.exeC:\program files\Yahoo!\Widgets\YahooWidgets.exeC:\home windows\ehome\RMSvc.exeC:\program data\Verizon\VSP\ServicepointService.exeC:\program data\VERIZONDM\bin\sprtsvc.exeC:\program data\Yahoo!\Widgets\YahooWidgets.exesvchost.exeC:\windows\system32\svchost.exe -ok imgsvcC:\application information\VERIZONDM\bin\tgsrvc.exeC:\application files\HP\Digital Imaging\bin\hpqSTE08.exeC:\program information\common files\Teleca Shared\prevalent.exeC:\software info\regular info\Teleca Shared\CapabilityManager.exeC:\software info\HTC\HTC Sync\ClientInitiatedStarter\ClientInitiatedStarter.exeC:\software files\HTC\HTC Sync\cellular telephone monitor\epmworker.exeC:\software data\HTC\HTC Sync\cell phone video display\HTCVBTServer.exeC:\program files\HTC\HTC Sync\cell phone display screen\FsynSrvStarter.exeC:\home windows\ALCXMNTR.EXEC:\application info\ATI applied sciences\ATI control Panel\atiptaxx.exec:\windows\equipment\hpsysdrv.exeC:\application info\iTunes\iTunesHelper.exeC:\program files\usual information\LogiShrd\LVCOMSER\LVComSer.exeC:\home windows\system32\dllhost.exeC:\application information\iPod\bin\iPodService.exeC:\documents and Settings\HP_Administrator\local Settings\application facts\Google\Chrome\software\chrome.exeC:\files and Settings\HP_Administrator\local Settings\utility facts\Google\Chrome\software\chrome.exeC:\documents and Settings\HP_Administrator\local Settings\utility facts\Google\Chrome\software\chrome.exeC:\home windows\eHome\ehmsas.exeC:\files and Settings\HP_Administrator\local Settings\utility facts\Google\Chrome\application\chrome.exeC:\files and Settings\HP_Administrator\native Settings\utility records\Google\Chrome\application\chrome.exeC:\documents and Settings\HP_Administrator\local Settings\software information\Google\Chrome\software\chrome.exeC:\files and Settings\HP_Administrator\native Settings\application information\Google\Chrome\utility\chrome.exeC:\files and Settings\HP_Administrator\native Settings\utility statistics\Google\Chrome\utility\chrome.exeC:\program info\Virus cleaner\dds.scr

============== Pseudo HJT document ===============

uStart web page = hxxp://www.google.com/uDefault_Search_URL = hxxp://ie.redirect.hp.com/svs/rdr?category=3&tp=iesearch&locale=EN_US&c=Q405&bd=pavilion&pf=desktop&parm1=seconduseruSearchMigratedDefaultURL = hxxp://www.google.com/search?q=searchTerms&sourceid=ie7&rls=com.microsoft:en-US&ie=utf8&oe=utf8mSearch Bar = hxxp://ie.redirect.hp.com/svs/rdr?classification=3&tp=iesearch&locale=EN_US&c=Q405&bd=pavilion&pf=computing device&parm1=seconduseruInternet Settings,ProxyOverride = <local>uInternet Settings,ProxyServer = http=127.0.0.1:8075uSearchURL,(Default) = hxxp://www.google.com/search?q=%suURLSearchHooks: AVG protection Toolbar BHO: a3bc75a2-1f87-4686-aa43-5347d756017c - c:\program information\avg\avg9\toolbar\IEToolbar.dllmURLSearchHooks: AVG protection Toolbar BHO: a3bc75a2-1f87-4686-aa43-5347d756017c - c:\application information\avg\avg9\toolbar\IEToolbar.dllBHO: Adobe PDF hyperlink Helper: 18df081c-e8ad-4283-a596-fa578c2ebdc3 - c:\program info\normal info\adobe\acrobat\activex\AcroIEHelperShim.dllBHO: AVG safe Search: 3ca2f312-6f6e-4b53-a66e-4e65e497c8c0 - c:\software information\avg\avg9\avgssie.dllBHO: AVG safety Toolbar BHO: a3bc75a2-1f87-4686-aa43-5347d756017c - c:\program files\avg\avg9\toolbar\IEToolbar.dllBHO: Skype add-on for cyber web Explorer: ae805869-2e5c-4ed4-8f7b-f1f7851a4497 - c:\program info\skype\toolbars\cyber web explorer\skypeieplugin.dllBHO: Google Toolbar Notifier BHO: af69de43-7d58-4638-b6fa-ce66b5ad205d - c:\application data\google\googletoolbarnotifier\5.6.5612.1312\swg.dllBHO: Java(tm) Plug-In 2 SSV Helper: dbc80044-a445-435b-bc74-9c25c1c588a9 - c:\software data\java\jre6\bin\jp2ssv.dllBHO: JQSIEStartDetectorImpl type: e7e6f031-17ce-4c07-bc86-eabfe594f69c - c:\software data\java\jre6\lib\install\jqs\ie\jqs_plugin.dllTB: AVG safety Toolbar: ccc7a320-b3ca-4199-b1a6-9f516dd69829 - c:\software data\avg\avg9\toolbar\IEToolbar.dllTB: &Google: 2318c2b1-4965-11d4-9b18-009027a5cd4f - c:\application information\google\googletoolbar3.dllTB: 42CDD1BF-3FFB-4238-8AD1-7859DF00B1D6 - No FileuRun: [ctfmon.exe] c:\home windows\system32\ctfmon.exeuRun: [swg] "c:\application info\google\googletoolbarnotifier\GoogleToolbarNotifier.exe"uRun: [WMPNSCFG] c:\program data\home windows media participant\WMPNSCFG.exeuRun: [Google Update] "c:\documents and settings\hp_administrator\native settings\utility information\google\replace\GoogleUpdate.exe" /cmRun: [KBD] c:\hp\kbd\KBD.EXEmRun: [HPHUPD08] "c:\software information\hp\digital imaging\33d6cc28-9f75-4d1b-a11d-98895b3a3729\hphupd08.exe"mRun: [HPBootOp] "c:\program data\hewlett-packard\hp boot optimizer\HPBootOp.exe" /runmRun: [ehTray] c:\windows\ehome\ehtray.exemRun: [Mobile Connectivity Suite] "c:\program data\htc\htc sync\utility launcher\application Launcher.exe" /startoptionsmRun: [Adobe Reader Speed Launcher] "c:\software files\adobe\reader 9.0\reader\Reader_sl.exe"mRun: [Adobe ARM] "c:\program information\ordinary information\adobe\arm\1.0\AdobeARM.exe"mRun: [Verizon_McciTrayApp] "c:\software files\verizon\McciTrayApp.exe"mRun: [VERIZONDM] "c:\application files\verizondm\bin\sprtcmd.exe" /P VERIZONDMmRun: [VerizonServicepoint.exe] "c:\software files\verizon\vsp\VerizonServicepoint.exe" /AUTORUNmRun: [Monitor] "c:\application info\leapfrog\leapfrog join\monitor.exe"mRunOnce: [Malwarebytes' Anti-Malware] c:\software info\mambo\mbamgui.exe /installation /silentStartupFolder: c:\docume~1\hp_adm~1\startm~1\classes\startup\yahoo!~1.lnk - c:\application info\yahoo!\widgets\YahooWidgets.exeStartupFolder: c:\docume~1\alluse~1\startm~1\courses\startup\adobeg~1.lnk - c:\software info\ordinary information\adobe\calibration\Adobe Gamma Loader.exeStartupFolder: c:\docume~1\alluse~1\startm~1\programs\startup\hpdigi~1.lnk - c:\software data\hp\digital imaging\bin\hpqtra08.exeStartupFolder: c:\docume~1\alluse~1\startm~1\courses\startup\micros~1.lnk - c:\software information\microsoft office\office10\OSA.EXEStartupFolder: c:\docume~1\alluse~1\startm~1\classes\startup\update~1.lnk - c:\program data\updates from hp\9972322\software\Updates from HP.exeIE: E&xport to Microsoft Excel - c:\progra~1\mi1933~1\office10\EXCEL.EXE/3000IE: AC9E2541-2814-11d5-BC6D-00B0D0A1DE45 - c:\program data\purpose\intention.exeIE: 898EA8C8-E7FF-479B-8935-AEC46303B9E5 - 898EA8C8-E7FF-479B-8935-AEC46303B9E5 - c:\program information\skype\toolbars\information superhighway explorer\skypeieplugin.dllDPF: vzTCPConfig - hxxp://my.verizon.com/micro/speedoptimizer/fios/vzTCPConfig.CABDPF: 0CCA191D-13A6-4E29-B746-314DEE697D83 - hxxp://upload.facebook.com/controls/2008.10.10_v5.5.eight/FacebookPhotoUploader5.cabDPF: 166B1BCA-3F9C-11CF-8075-444553540000 - hxxp://download.macromedia.com/pub/shockwave/cabs/director/sw.cabDPF: 30528230-99f7-4bb4-88d8-fa1d4f56a2ab - c:\application files\yahoo!\typical\Yinsthelper.dllDPF: 34F12AFD-E9B5-492A-85D2-40FA4535BE83 - hxxp://www.symantec.com/techsupp/activedata/nprdtinf.cabDPF: 3DCEC959-378A-4922-AD7E-FD5C925D927F - hxxp://disney.go.com/pirates/on-line/testActiveX/built/signed/DisneyOnlineGames.cabDPF: 406B5949-7190-4245-91A9-30A17DE16AD0 - hxxp://pictures.walmart.com/WalmartActivia.cabDPF: 48DD0448-9209-4F81-9F6D-D83562940134 - hxxp://lads.myspace.com/add/MySpaceUploader1006.cabDPF: 4F1E5B1A-2A80-42CA-8532-2D05CB959537 - hxxp://gfx1.hotmail.com/mail/w2/substances/MSNPUpld.cabDPF: 5D637FAD-E202-48D1-8F18-5B9C459BD1E3 - hxxps://www.designamosaic.com/include/aurigma/ImageUploader5.cabDPF: 6414512B-B978-451D-A0D8-FCFDF33E833C - hxxp://update.microsoft.com/microsoftupdate/v6/V5Controls/en/x86/customer/wuweb_site.cab?1178776720578DPF: 6A344D34-5231-452A-8A57-D064AC9B7862 - hxxps://webdl.symantec.com/activex/symdlmgr.cabDPF: 6E32070A-766D-4EE6-879C-DC1FA91D2FC3 - hxxp://replace.microsoft.com/microsoftupdate/v6/V5Controls/en/x86/client/muweb_site.cab?1178776707859DPF: 7530BFB8-7293-4D34-9923-61A11451AFC5 - hxxp://down load.eset.com/special/eos/OnlineScanner.cabDPF: 8100D56A-5661-482C-BEE8-AFECE305D968 - hxxp://upload.facebook.com/controls/2009.07.28_v5.5.eight.1/FacebookPhotoUploader55.cabDPF: 8A94C905-FF9D-43B6-8708-F0F22D22B1CB - hxxp://www.worldwinner.com/games/shared/wwlaunch.cabDPF: 8AD9C840-044E-11D1-B3E9-00805F499D93 - hxxp://java.solar.com/update/1.6.0/jinstall-1_6_0_18-windows-i586.cabDPF: 8FFBE65D-2C9C-4669-84BD-5829DC0B603C - hxxp://fpdownload.macromedia.com/get/flashplayer/latest/polarbear/ultrashim.cabDPF: 9C23D886-43CB-43DE-B2DB-112A68D7E10A - hxxp://lads.myspace.com/upload/MySpaceUploader2.cabDPF: CAFEEFAC-0016-0000-0018-ABCDEFFEDCBA - hxxp://java.solar.com/replace/1.6.0/jinstall-1_6_0_18-windows-i586.cabDPF: CAFEEFAC-FFFF-FFFF-FFFF-ABCDEFFEDCBA - hxxp://java.solar.com/replace/1.6.0/jinstall-1_6_0_18-home windows-i586.cabDPF: CF969D51-F764-4FBF-9E90-475248601C8A - hxxp://www.worldwinner.com/games/v47/familyfeud/familyfeud.cabDPF: D27CDB6E-AE6D-11CF-96B8-444553540000 - hxxp://fpdownload.macromedia.com/get/flashplayer/existing/swflash.cabDPF: E2883E8F-472F-4FB0-9522-AC9BF37916A7 - hxxp://platformdl.adobe.com/NOS/getPlusPlus/1.6/gp.cabDPF: E77F23EB-E7AB-4502-8F37-247DBAF1A147 - hxxp://gfx1.hotmail.com/mail/w4/pr01/photouploadcontrol/MSNPUpld.cabHandler: avgsecuritytoolbar - F2DDE6B2-9684-4A55-86D4-E255E237B77C - c:\program data\avg\avg9\toolbar\IEToolbar.dllHandler: bwfile-8876480 - 9462A756-7B47-47BC-8C80-C34B9B80B32B - c:\software info\logitech\desktop messenger\8876480\software\GAPlugProtocol-8876480.dllHandler: linkscanner - F274614C-63F8-47D5-A4D1-FBDDE494F8D1 - c:\software information\avg\avg9\avgpp.dllHandler: skype-ie-addon-information - 91774881-D725-4E58-B298-07617B9B86A8 - c:\program files\skype\toolbars\internet explorer\skypeieplugin.dllHandler: skype4com - FFC8B962-9B40-4DFF-9458-1830C7DD7F5D - c:\progra~1\normal~1\skype\SKYPE4~1.DLLNotify: AtiExtEvent - Ati2evxx.dllNotify: avgrsstarter - avgrsstx.dllSSODL: WPDShServiceObj - AAA288BA-9A4C-45B0-95D7-94D524869DB5 - c:\windows\system32\WPDShServiceObj.dll

================= FIREFOX ===================

FF - ProfilePath - c:\docume~1\hp_adm~1\applic~1\mozilla\firefox\profiles\si0zd40m.default\FF - prefs.js: browser.search.selectedEngine - AVG secure SearchFF - prefs.js: browser.startup.homepage - hxxp://www22.verizon.com/Foryourhome/MyAccount/Unprotected/UserManagement/Login/Login.aspx|http://my.verizon.comFF - prefs.js: keyword.URL - hxxp://search.avg.com/route/?d=4b9b21fa&v=6.010.006.004&i=23&tp=ab&iy=&ychte=us&lng=en-US&q=FF - component: c:\software info\avg\avg9\toolbar\firefox\avg@igeared\components\IGeared_tavgp_xputils2.dllFF - component: c:\software information\avg\avg9\toolbar\firefox\avg@igeared\components\IGeared_tavgp_xputils3.dllFF - element: c:\application data\avg\avg9\toolbar\firefox\avg@igeared\add-ons\IGeared_tavgp_xputils35.dllFF - component: c:\application info\avg\avg9\toolbar\firefox\avg@igeared\components\xpavgtbapi.dllFF - plugin: c:\documents and settings\hp_administrator\utility information\circulate networks\plugins\npqmp071503000010.dllFF - plugin: c:\files and settings\hp_administrator\native settings\software records\google\update\1.2.183.39\npGoogleOneClick8.dllFF - plugin: c:\program data\normal info\purpose\npMotive.dllFF - plugin: c:\application info\complete immersion\dfusionhomewebplugin\NPDFusionWebFirefox.dllFF - plugin: c:\software data\unity\webplayer\loader\npUnity3D32.dllFF - plugin: c:\program info\verizon\vsp\nprpspa.dllFF - HiddenExtension: Microsoft .net Framework Assistant: 20a82645-c095-46ed-80e3-08825760534b - c:\windows\microsoft.net\framework\v3.5\home windows presentation foundation\dotnetassistantextension\

---- FIREFOX policies ----c:\program files\mozilla firefox\greprefs\all.js - pref("ui.use_native_colors", genuine);c:\application data\mozilla firefox\greprefs\all.js - pref("ui.use_native_popup_windows", false);c:\program data\mozilla firefox\greprefs\all.js - pref("browser.enable_click_image_resizing", real);c:\program files\mozilla firefox\greprefs\all.js - pref("accessibility.browsewithcaret_shortcut.enabled", authentic);c:\program data\mozilla firefox\greprefs\all.js - pref("javascript.alternatives.mem.high_water_mark", 32);c:\application data\mozilla firefox\greprefs\all.js - pref("javascript.alternatives.mem.gc_frequency", 1600);c:\software files\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.lu", real);c:\program data\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.nu", real);c:\application information\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.nz", actual);c:\program data\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.xn--mgbaam7a8h", real);c:\application data\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.xn--fiqz9s", authentic); // Traditionalc:\software files\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.xn--fiqs8s", real); // Simplifiedc:\program info\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.xn--j6w193g", actual);c:\software information\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.xn--mgbayh7gpa", actual);c:\application files\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.xn--p1ai", genuine);c:\program data\mozilla firefox\greprefs\all.js - pref("network.IDN.whitelist.xn--mgberp4a5d4ar", real);c:\program info\mozilla firefox\greprefs\all.js - pref("network.IDN.whitelist.xn--mgberp4a5d4a87g", authentic);c:\program information\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.xn--mgbqly7c0a67fbc", authentic);c:\application info\mozilla firefox\greprefs\all.js - pref("community.IDN.whitelist.xn--mgbqly7cvafr", authentic);c:\application files\mozilla firefox\greprefs\all.js - pref("network.IDN.whitelist.xn--kpry57d", real); // Traditionalc:\application data\mozilla firefox\greprefs\all.js - pref("network.IDN.whitelist.xn--kprw13d", proper); // Simplifiedc:\software info\mozilla firefox\greprefs\all.js - pref("network.IDN.whitelist.tel", authentic);c:\program data\mozilla firefox\greprefs\all.js - pref("network.auth.force-prevalent-ntlm", false);c:\application info\mozilla firefox\greprefs\all.js - pref("community.proxy.type", 5);c:\program info\mozilla firefox\greprefs\all.js - pref("network.buffer.cache.count", 24);c:\application files\mozilla firefox\greprefs\all.js - pref("network.buffer.cache.dimension", 4096);c:\software information\mozilla firefox\greprefs\all.js - pref("dom.ipc.plugins.timeoutSecs", forty five);c:\application information\mozilla firefox\greprefs\all.js - pref("svg.smil.enabled", false);c:\application data\mozilla firefox\greprefs\all.js - pref("ui.trackpoint_hack.enabled", -1);c:\software info\mozilla firefox\greprefs\all.js - pref("browser.formfill.debug", false);c:\program data\mozilla firefox\greprefs\all.js - pref("browser.formfill.agedWeight", 2);c:\program information\mozilla firefox\greprefs\all.js - pref("browser.formfill.bucketSize", 1);c:\program files\mozilla firefox\greprefs\all.js - pref("browser.formfill.maxTimeGroupings", 25);c:\application information\mozilla firefox\greprefs\all.js - pref("browser.formfill.timeGroupingSize", 604800);c:\application files\mozilla firefox\greprefs\all.js - pref("browser.formfill.boundaryWeight", 25);c:\program information\mozilla firefox\greprefs\all.js - pref("browser.formfill.prefixWeight", 5);c:\application info\mozilla firefox\greprefs\all.js - pref("accelerometer.enabled", real);c:\application files\mozilla firefox\greprefs\security-prefs.js - pref("safety.ssl.allow_unrestricted_renego_everywhere__temporarily_available_pref", authentic);c:\software information\mozilla firefox\greprefs\safety-prefs.js - pref("security.ssl.renego_unrestricted_hosts", "");c:\software data\mozilla firefox\greprefs\safety-prefs.js - pref("safety.ssl.treat_unsafe_negotiation_as_broken", false);c:\application files\mozilla firefox\greprefs\security-prefs.js - pref("safety.ssl.require_safe_negotiation", false);c:\software files\mozilla firefox\greprefs\safety-prefs.js - pref("safety.ssl3.rsa_seed_sha", genuine);c:\software information\mozilla firefox\defaults\pref\firefox-branding.js - pref("app.replace.download.backgroundInterval", 600);c:\program files\mozilla firefox\defaults\pref\firefox-branding.js - pref("app.update.url.manual", "http://www.firefox.com");c:\software info\mozilla firefox\defaults\pref\firefox-branding.js - pref("browser.search.param.yahoo-fr-ja", "mozff");c:\application files\mozilla firefox\defaults\pref\firefox.js - pref("extensions.972ce4c6-7e08-4474-a285-3208198ce6fd.name", "chrome://browser/locale/browser.properties");c:\application data\mozilla firefox\defaults\pref\firefox.js - pref("extensions.972ce4c6-7e08-4474-a285-3208198ce6fd.description", "chrome://browser/locale/browser.properties");c:\program info\mozilla firefox\defaults\pref\firefox.js - pref("xpinstall.whitelist.add", "addons.mozilla.org");c:\software files\mozilla firefox\defaults\pref\firefox.js - pref("xpinstall.whitelist.add.36", "getpersonas.com");c:\software info\mozilla firefox\defaults\pref\firefox.js - pref("lightweightThemes.update.enabled", authentic);c:\software files\mozilla firefox\defaults\pref\firefox.js - pref("browser.allTabs.previews", false);c:\application information\mozilla firefox\defaults\pref\firefox.js - pref("plugins.hide_infobar_for_outdated_plugin", false);c:\application files\mozilla firefox\defaults\pref\firefox.js - pref("plugins.replace.notifyUser", false);c:\program data\mozilla firefox\defaults\pref\firefox.js - pref("toolbar.customization.usesheet", false);c:\software info\mozilla firefox\defaults\pref\firefox.js - pref("dom.ipc.plugins.enabled.nptest.dll", true);c:\program info\mozilla firefox\defaults\pref\firefox.js - pref("dom.ipc.plugins.enabled.npswf32.dll", proper);c:\software information\mozilla firefox\defaults\pref\firefox.js - pref("dom.ipc.plugins.enabled.npctrl.dll", real);c:\application information\mozilla firefox\defaults\pref\firefox.js - pref("dom.ipc.plugins.enabled.npqtplugin.dll", real);c:\application information\mozilla firefox\defaults\pref\firefox.js - pref("dom.ipc.plugins.enabled", false);c:\software data\mozilla firefox\defaults\pref\firefox.js - pref("browser.taskbar.previews.allow", false);c:\application info\mozilla firefox\defaults\pref\firefox.js - pref("browser.taskbar.previews.max", 20);c:\software info\mozilla firefox\defaults\pref\firefox.js - pref("browser.taskbar.previews.cachetime", 20);

============= capabilities / DRIVERS ===============

R1 AvgLdx86;AVG Free AVI Loader Driver x86;c:\home windows\system32\drivers\avgldx86.sys [2010-3-12 216400]R1 AvgMfx86;AVG Free On-access Scanner Minifilter Driver x86;c:\windows\system32\drivers\avgmfx86.sys [2010-3-12 29584]R1 AvgTdiX;AVG Free network Redirector;c:\windows\system32\drivers\avgtdix.sys [2010-3-12 243024]R2 avg9wd;AVG Free WatchDog;c:\software info\avg\avg9\avgwdsvc.exe [2010-7-17 308136]R2 IHA_MessageCenter;IHA_MessageCenter;c:\software data\verizon\iha_messagecenter\bin\Verizon_IHAMessageCenter.exe [2010-10-13 98304]R2 McrdSvc;Media center Extender provider;c:\home windows\ehome\McrdSvc.exe [2005-10-20 96256]R2 ServicepointService;ServicepointService;c:\application info\verizon\vsp\ServicepointService.exe [2010-12-9 689392]R2 sprtsvc_verizondm;SupportSoft Sprocket service (verizondm);c:\software files\verizondm\bin\sprtsvc.exe [2010-9-29 206120]R2 tgsrvc_verizondm;SupportSoft repair service (verizondm);c:\application files\verizondm\bin\tgsrvc.exe [2010-9-29 185640]R3 WsAudio_DeviceS(1);WsAudio_DeviceS(1);c:\home windows\system32\drivers\WsAudio_DeviceS(1).sys [2009-12-10 25704]R3 WsAudio_DeviceS(2);WsAudio_DeviceS(2);c:\windows\system32\drivers\WsAudio_DeviceS(2).sys [2009-12-10 25704]R3 WsAudio_DeviceS(three);WsAudio_DeviceS(three);c:\windows\system32\drivers\WsAudio_DeviceS(three).sys [2009-12-10 25704]R3 WsAudio_DeviceS(4);WsAudio_DeviceS(4);c:\windows\system32\drivers\WsAudio_DeviceS(four).sys [2009-12-10 25704]R3 WsAudio_DeviceS(5);WsAudio_DeviceS(5);c:\windows\system32\drivers\WsAudio_DeviceS(5).sys [2009-12-10 25704]S3 AVG security Toolbar provider;AVG protection Toolbar provider;c:\program information\avg\avg9\toolbar\ToolbarBroker.exe [2010-10-26 517448]S3 FlyUsb;FLY Fusion;c:\windows\system32\drivers\FlyUsb.sys [2011-1-19 18560]S3 HTCAND32;HTC equipment Driver;c:\home windows\system32\drivers\ANDROIDUSB.sys [2010-6-8 24576]S4 Brmtsa;Brmtsa;c:\home windows\system32\drivers\qwavedrv.sys [2005-10-20 14336]

=============== Created final 30 ================

==================== Find3M ====================

2011-01-20 16:25:25 0 ----a-w- c:\windows\system32\drivers\lvuvc.hs2011-01-20 16:25:23 0 ----a-w- c:\windows\system32\drivers\logiflt.iad2010-12-21 02:09:00 38224 ----a-w- c:\windows\system32\drivers\mbamswissarmy.sys2010-12-21 02:08:40 20952 ----a-w- c:\home windows\system32\drivers\mbam.sys2010-eleven-18 18:12:44 81920 ----a-w- c:\home windows\system32\isign32.dll2010-11-18 18:12:44 81920 ------w- c:\windows\system32\dllcache\isign32.dll2010-eleven-18 05:54:24 53864 ----a-w- c:\windows\system32\GDIPFONTCACHEV1.DAT2010-11-09 14:52:35 536576 ------w- c:\windows\system32\dllcache\msado15.dll2010-eleven-09 14:fifty two:35 249856 ----a-w- c:\windows\system32\odbc32.dll2010-11-09 14:fifty two:35 249856 ------w- c:\home windows\system32\dllcache\odbc32.dll2010-eleven-09 14:52:35 200704 ------w- c:\home windows\system32\dllcache\msadox.dll2010-11-09 14:fifty two:35 180224 ------w- c:\home windows\system32\dllcache\msadomd.dll2010-eleven-09 14:52:35 143360 ------w- c:\home windows\system32\dllcache\msadco.dll2010-11-09 14:fifty two:35 102400 ------w- c:\home windows\system32\dllcache\msjro.dll2010-11-03 12:24:56 13824 ----a-w- c:\home windows\system32\dllcache\ieudinit.exe2010-11-03 12:24:fifty five 70656 ----a-w- c:\home windows\system32\dllcache\ie4uinit.exe2010-eleven-02 15:17:02 40960 ------w- c:\home windows\system32\dllcache\ndproxy.sys2010-10-28 13:13:22 290048 ----a-w- c:\home windows\system32\atmfd.dll2010-10-28 13:13:22 290048 ------w- c:\windows\system32\dllcache\atmfd.dll2010-10-26 13:25:00 1853312 ----a-w- c:\windows\system32\win32k.sys2010-10-26 13:25:00 1853312 ----a-w- c:\windows\system32\dllcache\win32k.sys2010-09-09 00:47:eleven 1627352 ----a-w- c:\software info\PowerISO47.exe2010-09-09 00:29:25 9591104 ----a-w- c:\application info\DTLite4356-0091.exe2007-10-03 16:29:29 28556584 ----a-w- c:\application info\avg75free_488a1138.exe2007-10-03 16:28:18 19755376 ----a-w- c:\software information\aaw2007.exe2007-10-03 sixteen:01:56 16892616 ----a-w- c:\program data\setupeng.exe2007-07-22 16:05:30 305152 ----a-w- c:\application information\windiag.iso2007-06-20 16:23:20 21736784 ----a-w- c:\application info\DivXInstaller.exe2006-10-22 04:01:23 681459594 ----a-w- c:\application files\Postal2STP.exe2006-07-26 02:17:00 10765549 ----a-w- c:\software info\RoadRunnerMedic.exe2005-11-09 sixteen:37:fifty nine 11590784 ----a-w- c:\program information\DivXPlay.exe2010-05-21 04:20:08 16384 --sha-w- c:\home windows\system32\config\systemprofile\cookies\index.dat2010-05-21 04:20:08 147456 --sha-w- c:\windows\system32\config\systemprofile\local settings\historical past\background.ie5\index.dat2008-12-08 16:59:19 65536 --sha-w- c:\windows\system32\config\systemprofile\local settings\heritage\background.ie5\mshist012008120120081208\index.dat2008-12-09 04:52:eleven 32768 --sha-w- c:\windows\system32\config\systemprofile\local settings\background\heritage.ie5\mshist012008120820081209\index.dat2008-12-10 04:21:09 32768 --sha-w- c:\windows\system32\config\systemprofile\native settings\heritage\history.ie5\mshist012008120920081210\index.dat2008-12-11 01:forty four:54 32768 --sha-w- c:\windows\system32\config\systemprofile\native settings\historical past\history.ie5\mshist012008121020081211\index.dat2010-05-21 04:20:08 32768 --sha-w- c:\windows\system32\config\systemprofile\native settings\temporary information superhighway information\content material.ie5\index.dat

============= finish: 13:21:57.18 ===============DDA connect log

until peculiarly recommended, do not publish THIS LOG.IF REQUESTED, ZIP IT UP & connect IT

DDS (Ver_09-12-01.01)

Microsoft windows XP ProfessionalBoot equipment: \machine\HarddiskVolume2Install Date: 2/27/2007 4:fifty seven:38 PMSystem Uptime: 1/20/2011 8:25:00 AM (5 hours ago)

Motherboard: MSI | | AMETHYST-MProcessor: AMD Athlon(tm) sixty four X2 twin Core Processor 3800+ | Socket 939 | 1790/200mhz

==== Disk Partitions =========================

C: is fixed (NTFS) - 225 GiB complete, 113.076 GiB free.D: is mounted (FAT32) - 8 GiB complete, 5 GiB free.E: is CDROM ()F: is CDROM ()G: is RemovableH: is RemovableI: is RemovableJ: is RemovableK: is CDROM ()L: is CDROM ()

==== Disabled device manager items =============

category GUID:Description: PCI basic Communications ControllerDevice id: PCI\VEN_11C1&DEV_048C&SUBSYS_00004020&REV_03\4&1C88B56&0&08A4Manufacturer:identify: PCI simple Communications ControllerPNP device id: PCI\VEN_11C1&DEV_048C&SUBSYS_00004020&REV_03\4&1C88B56&0&08A4Service:

==== device repair points ===================

RP631: 1/15/2011 1:24:49 PM - system CheckpointRP632: 1/18/2011 7:33:15 PM - equipment CheckpointRP633: 1/19/2011 9:07:forty three PM - equipment Checkpoint

==== put in classes ======================

µTorrent2570_Help2570TrbAbiWord 2.eight.4Acrobat.comAdobe AIRAdobe Flash participant 10 ActiveXAdobe Flash participant 10 PluginAdobe Photoshop CSAdobe Reader 9.4.1Adobe Shockwave participant 11Advanced SystemCare 3Agere methods PCI soft ModemAiO_ScanAiO_Scan_CDAAiOSoftwareAiOSoftwareNPIAny Video Converter three.0.5Apple utility SupportApple cell device SupportApple software UpdateArcSoft Print CreationsArcSoft Print Creations - Album PageArcSoft Print Creations - FunhouseArcSoft Print Creations - Greeting CardArcSoft Print Creations - photo BookArcSoft Print Creations - picture CalendarArcSoft Print Creations - ScrapbookArcSoft Print Creations - Slimline CardATI handle PanelATI monitor DriverAVG Free 9.0Azureus LauncherBonjourBufferChmCameraDriversCCScoreCP_AtenaShokunin1ConfigCP_CalendarTemplates1CP_Package_Basic1CP_Package_Variety1CP_Package_Variety2CP_Package_Variety3CP_Panorama1ConfigCritical update for windows Media player 11 (KB959772)CueTourDaniusoft Digital tune Converter(build 2.5.0.0)DestinationsDeviceManagementQFolderDivX ConverterDivX PlayerDivX internet PlayerDocProcDocumentViewerDocumentViewerQFolderEnhanced Multimedia Keyboard SolutionESET on-line Scanner v3ESSBrwrESSCDBKESScoreESSguiESSiniESSPCDESSPDockESSTOOLSessvatgtFaxFax_CDAfflinkFLV participant 2.0 (construct 25)Free Convert to DIVX AVI WMV MP4 MPEG Converter 5.8Glary Utilities 2.20.0.831Google ChromeGoogle Toolbar for web ExplorerHigh Definition Audio Driver kit - KB888111HijackThis 2.0.2Hotfix for Microsoft .net Framework 3.5 SP1 (KB953595)Hotfix for Microsoft .web Framework three.5 SP1 (KB958484)Hotfix for windows cyber web Explorer 7 (KB947864)Hotfix for windows Media layout 11 SDK (KB929399)Hotfix for home windows Media participant 10 (KB903157)Hotfix for windows Media player eleven (KB939683)Hotfix for windows XP (KB2158563)Hotfix for home windows XP (KB2443685)Hotfix for windows XP (KB895961-v4)Hotfix for home windows XP (KB932716-v2)Hotfix for windows XP (KB945060-v3)Hotfix for windows XP (KB952287)Hotfix for windows XP (KB954550-v5)Hotfix for windows XP (KB961118)Hotfix for windows XP (KB970653-v3)Hotfix for home windows XP (KB976098-v2)Hotfix for windows XP (KB979306)Hotfix for windows XP (KB981793)HP Boot OptimizerHP Deskjet Printer PreloadHP DigitalMedia ArchiveHP doc Viewer 5.3HP photo Zone 5.3HP image Zone for Media middle PCHP Imaging device functions 5.3HP Photosmart 330,380,420,470,7800,8000,8200 SeriesHP Photosmart Cameras 5.0HP Product AssistantHP PSC & OfficeJet 5.3.AHP PSC & OfficeJet 5.three.BHP answer middle & Imaging assist equipment 5.3HP TunesHP UpdateHPProductAssistantHpSdpAppCoreAppHTC Driver InstallerHTC SyncIHA_MessageCenterInstantShareDevicesIntelliMover information switch DemoInterActual PlayerInterVideo WinDVD PlayeriTunesJava Auto UpdaterJava(TM) 6 update 18K-Lite Codec Pack 4.0.0 (Full)kgcbabykgchdaykgchlwnkgcinvtkgckidskgcmovekgcvdayKodak EasyShare softwareLeapFrog ConnectLeapFrog Tag Junior PluginLightScribe 1.4.31.1Logitech computing device MessengerLogitech QuickCamLogitech QuickCam Driver PackageLogitech UpdaterMalwarebytes' Anti-MalwareMedia middle ExtenderMicrosoft .web Framework 1.0 Hotfix (KB953295)Microsoft .web Framework 1.0 Hotfix (KB979904)Microsoft .web Framework 1.1Microsoft .internet Framework 1.1 protection replace (KB2416447)Microsoft .internet Framework 1.1 safety replace (KB979906)Microsoft .internet Framework 2.0 carrier Pack 2Microsoft .web Framework three.0 provider Pack 2Microsoft .web Framework three.5 SP1Microsoft Compression customer Pack 1.0 for windows XPMicrosoft Internationalized domain names Mitigation APIsMicrosoft Kernel-Mode Driver Framework characteristic Pack 1.7Microsoft money 2005Microsoft national Language assist Downlevel APIsMicrosoft workplace XP Media ContentMicrosoft workplace XP usual for college kids and TeachersMicrosoft Plus! Dancer LEMicrosoft Plus! Digital Media edition InstallerMicrosoft Plus! photograph Story 2 LEMicrosoft SilverlightMicrosoft consumer-Mode Driver Framework feature Pack 1.0Microsoft visible C++ 2005 ATL update kb973923 - x86 8.0.50727.4053Microsoft visual C++ 2005 RedistributableMicrosoft visible C++ 2008 ATL update kb973924 - x86 9.0.30729.4148Microsoft visible C++ 2008 Redistributable - x86 9.0.21022Microsoft WorksMicrosoft WSE three.0 RuntimeMobileMe manage PanelMove Media PlayerMozilla Firefox (3.6.12)MSXML 4.0 SP2 (KB927978)MSXML 4.0 SP2 (KB936181)MSXML 4.0 SP2 (KB954430)MSXML four.0 SP2 (KB973688)MSXML four.0 SP3 Parser (KB973685)MSXML 6.0 Parser (KB933579)muvee autoProducer four.0muvee autoProducer unPlugged 1.1 - HPDNapster down load ManagernetbrdgNewCopyNewCopy_CDAOffice 2003 TourOfotoXMIOpenALOttoPanoStandAlonePC-doctor 5 for WindowsPhotoGalleryPowerISOProductContextNPIPS2PSPrinters08PSTAPluginPython 2.2 pywin32 extensions (build 203)Python 2.2.3QFolderQuicken 2005QuickTimeRandMapReadmeRealPlayerRedistRhapsody participant EngineSafariSAMSUNG mobile USB DRIVER(four.40.7.0) v1.6ScanScannerCopySecurity replace for CAPICOM (KB931906)protection replace for Microsoft .net Framework three.5 SP1 (KB2416473)safety replace for little by little Interactive working towards (KB923723)protection replace for windows internet Explorer 7 (KB2183461)safety update for home windows cyber web Explorer 7 (KB2360131)protection update for home windows internet Explorer 7 (KB2416400)security replace for home windows information superhighway Explorer 7 (KB929969)security replace for windows web Explorer 7 (KB931768)security update for windows information superhighway Explorer 7 (KB933566)safety update for windows information superhighway Explorer 7 (KB937143)safety replace for windows internet Explorer 7 (KB938127)security update for windows web Explorer 7 (KB939653)safety update for windows web Explorer 7 (KB942615)safety update for windows web Explorer 7 (KB944533)security replace for windows internet Explorer 7 (KB950759)protection update for home windows information superhighway Explorer 7 (KB953838)safety update for windows information superhighway Explorer 7 (KB956390)protection replace for windows web Explorer 7 (KB958215)security replace for windows information superhighway Explorer 7 (KB960714)protection update for windows internet Explorer 7 (KB961260)safety replace for home windows internet Explorer 7 (KB963027)protection update for windows internet Explorer 7 (KB969897)safety update for home windows web Explorer 7 (KB972260)safety replace for home windows web Explorer 7 (KB974455)protection replace for home windows information superhighway Explorer 7 (KB976325)protection update for windows internet Explorer 7 (KB978207)protection replace for home windows web Explorer 7 (KB982381)safety replace for home windows Media participant (KB2378111)security update for home windows Media player (KB952069)safety replace for home windows Media participant (KB954155)security update for windows Media player (KB968816)safety replace for home windows Media player (KB973540)security update for home windows Media player (KB975558)safety update for home windows Media participant (KB978695)security update for home windows Media player 10 (KB917734)security replace for home windows Media participant 10 (KB936782)protection update for windows Media player 11 (KB936782)safety replace for windows Media participant eleven (KB954154)security update for windows XP (KB2079403)security replace for home windows XP (KB2115168)protection update for windows XP (KB2121546)security update for windows XP (KB2160329)security update for windows XP (KB2229593)protection replace for windows XP (KB2259922)security update for home windows XP (KB2279986)safety update for home windows XP (KB2286198)security replace for home windows XP (KB2296011)security update for home windows XP (KB2296199)protection replace for home windows XP (KB2347290)safety update for home windows XP (KB2360937)security update for windows XP (KB2387149)security update for windows XP (KB2419632)security update for home windows XP (KB2423089)safety update for home windows XP (KB2436673)protection update for home windows XP (KB2440591)protection update for home windows XP (KB2443105)safety replace for windows XP (KB923561)security replace for home windows XP (KB938464)safety replace for home windows XP (KB941569)security replace for home windows XP (KB946648)safety update for windows XP (KB950760)protection replace for windows XP (KB950762)security update for home windows XP (KB950974)safety update for windows XP (KB951066)safety replace for windows XP (KB951376-v2)protection replace for windows XP (KB951376)protection replace for windows XP (KB951698)protection replace for windows XP (KB951748)safety update for home windows XP (KB952004)security update for home windows XP (KB952954)safety replace for windows XP (KB953839)security update for home windows XP (KB954211)safety replace for windows XP (KB954459)safety update for windows XP (KB954600)safety update for home windows XP (KB955069)protection update for windows XP (KB956391)security replace for windows XP (KB956572)safety update for windows XP (KB956744)protection replace for home windows XP (KB956802)security replace for home windows XP (KB956803)protection update for windows XP (KB956841)security replace for home windows XP (KB956844)safety update for home windows XP (KB957095)safety update for windows XP (KB957097)protection update for windows XP (KB958644)safety update for windows XP (KB958687)protection update for home windows XP (KB958690)protection replace for home windows XP (KB958869)safety update for home windows XP (KB959426)security replace for windows XP (KB960225)protection replace for windows XP (KB960715)security replace for windows XP (KB960803)safety update for home windows XP (KB960859)protection replace for home windows XP (KB961371)safety update for windows XP (KB961373)protection replace for windows XP (KB961501)safety replace for home windows XP (KB968537)protection update for home windows XP (KB969059)security replace for home windows XP (KB969898)protection update for home windows XP (KB969947)safety update for home windows XP (KB970238)security update for windows XP (KB970430)safety replace for windows XP (KB971468)security replace for home windows XP (KB971486)security replace for home windows XP (KB971557)safety update for windows XP (KB971633)security update for home windows XP (KB971657)safety update for windows XP (KB971961)protection update for windows XP (KB972270)protection update for home windows XP (KB973346)protection update for windows XP (KB973354)security replace for home windows XP (KB973507)security update for home windows XP (KB973525)security replace for windows XP (KB973869)protection update for windows XP (KB973904)protection replace for windows XP (KB974112)security replace for windows XP (KB974318)safety update for home windows XP (KB974392)safety update for windows XP (KB974571)safety update for windows XP (KB975025)security replace for windows XP (KB975467)safety replace for home windows XP (KB975560)security update for windows XP (KB975561)safety replace for windows XP (KB975562)protection update for windows XP (KB975713)security update for windows XP (KB977165)safety replace for windows XP (KB977816)security update for home windows XP (KB977914)security update for windows XP (KB978037)protection replace for home windows XP (KB978251)safety update for home windows XP (KB978262)safety update for home windows XP (KB978338)security update for home windows XP (KB978542)security replace for windows XP (KB978601)security update for home windows XP (KB978706)security update for windows XP (KB979309)safety update for windows XP (KB979482)security update for home windows XP (KB979559)security replace for home windows XP (KB979683)security update for windows XP (KB979687)protection update for windows XP (KB980195)security update for home windows XP (KB980218)safety replace for windows XP (KB980232)security update for home windows XP (KB980436)safety replace for windows XP (KB981322)security replace for home windows XP (KB981349)security update for windows XP (KB981852)safety update for home windows XP (KB981957)safety replace for home windows XP (KB981997)safety replace for home windows XP (KB982132)protection replace for home windows XP (KB982214)protection update for home windows XP (KB982665)protection update for home windows XP (KB982802)SFRSHASTASierra Utilitiesskin0001SkinsHP1SKINXSDKSkype ToolbarsSkype™ four.2Smart DefragSolutionCenterSonic EncodersSonic categorical LabelerSonic RecordNow AudioSonic RecordNow CopySonic RecordNow DataSonic replace ManagerSonic_PrimoSDKSprint Digital LoungeSpywareBlaster 4.4staticcrStatustooltipsTotal Immersion D'Fusion net PluginTrayAppUnity web PlayerUnloadUnlocker 1.8.7Update for Microsoft .internet Framework three.5 SP1 (KB963707)replace for home windows information superhighway Explorer 7 (KB976749)update for home windows web Explorer 7 (KB980182)replace for windows Media player 10 (KB913800)update for home windows Media player 10 (KB926251)update for home windows XP (KB2141007)replace for windows XP (KB2345886)replace for windows XP (KB2467659)replace for home windows XP (KB951072-v2)replace for home windows XP (KB951978)update for home windows XP (KB953356)replace for home windows XP (KB955759)update for windows XP (KB955839)replace for home windows XP (KB967715)replace for home windows XP (KB968389)replace for windows XP (KB971737)replace for windows XP (KB973687)replace for windows XP (KB973815)update Rollup 2 for home windows XP Media core edition 2005Updates from HP (eradicate most effective)Use the entry named LeapFrog connect with uninstall (LeapFrog Tag Junior Plugin)Verizon download ManagerVerizon support and guide ToolVerizon Media ManagerVerizon Servicepoint 3.5.18VPRINTOLVz In home AgentWebFldrs XPWebRegWindows Driver equipment - LeapFrog (FlyUsb) USB (eleven/05/2008 1.1.1.0)windows Driver equipment - Leapfrog (Leapfrog-USBLAN) net (09/10/2009 02.03.05.012)windows exact skills Notifications (KB905474)home windows exact competencies Validation device (KB892130)home windows internet Explorer 7Windows Media layout eleven runtimeWindows Media participant 10 Hotfix [See KB889858 for more information]home windows Media player 11Windows XP Media core edition 2005 KB888316Windows XP Media middle version 2005 KB890629Windows XP Media middle version 2005 KB895678Windows XP Media middle version 2005 KB905589Windows XP Media middle edition 2005 KB925766Windows XP Media core edition 2005 KB973768Windows XP provider Pack 3WIRELESSYahoo! installation ManagerYahoo! Widgets

==== event Viewer Messages From past Week ========

1/14/2011 7:23:03 AM, error: carrier handle manager [7022] - The IHA_MessageCenter carrier hung on beginning.1/14/2011 7:22:01 AM, error: WMPNetworkSvc [14344] - a brand new media server became no longer initialized as a result of WMCreateDeviceRegistration() encountered error '0x80070057'. The windows Media DRM accessories for your computer might possibly be corrupted. check that covered information play as it should be in windows Media participant, and then restart the WMPNetworkSvc service.1/14/2011 6:59:41 AM, error: carrier manage supervisor [7026] - here boot-beginning or equipment-start driver(s) didn't load: iaStor IntelIde ViaIde1/14/2011 12:14:41 PM, error: DCOM [10005] - DCOM got error "%1084" making an attempt to beginning the provider StiSvc with arguments "" as a way to run the server: A1F4E726-8CF1-11D1-BF92-0060081ED8111/14/2011 eleven:forty seven:03 AM, error: DCOM [10005] - DCOM got error "%1084" making an attempt to beginning the service EventSystem with arguments "" with a purpose to run the server: 1BE1F766-5536-11D1-B726-00C04FB926AF1/14/2011 eleven:44:fifty four AM, error: carrier handle manager [7026] - the following boot-delivery or device-beginning driver(s) did not load: AmdK8 AvgLdx86 AvgMfx86 Fips SCDEmu1/13/2011 10:02:05 PM, error: carrier control supervisor [7034] - The iPod carrier service terminated unexpectedly. It has accomplished this 1 time(s).

==== end Of File ===========================So what does it seem like? respectable? the rest I may still do?


Whilst it is very hard task to choose reliable test questions / answers resources regarding review, reputation and validity because people get ripoff due to choosing incorrect service. Killexams. com make it certain to provide its clients far better to their resources with respect to test dumps update and validity. Most of other peoples ripoff report complaint clients come to us for the brain dumps and pass their exams enjoyably and easily. We never compromise on our review, reputation and quality because killexams review, killexams reputation and killexams client self confidence is important to all of us. Specially we manage killexams.com review, killexams.com reputation, killexams.com ripoff report complaint, killexams.com trust, killexams.com validity, killexams.com report and killexams.com scam. If perhaps you see any bogus report posted by our competitor with the name killexams ripoff report complaint internet, killexams.com ripoff report, killexams.com scam, killexams.com complaint or something like this, just keep in mind that there are always bad people damaging reputation of good services due to their benefits. There are a large number of satisfied customers that pass their exams using killexams.com brain dumps, killexams PDF questions, killexams practice questions, killexams test simulator. Visit Killexams.com, our test questions and demo brain dumps, our test simulator and you will definitely know that killexams.com is the best brain dumps site.


HP0-M102 questions and answers | VCP-101V practice questions | 1Z0-489 test prep | 000-M46 braindumps | MOS-EXP demo test | C5050-408 real questions | C2090-549 cram | 000-208 test questions | HP0-876 test prep | 600-511 pdf download | A2010-578 practice test | 642-162 free pdf | 9L0-314 practice questions | E20-260 test questions | 1T6-540 braindumps | FCNSP.V5 braindumps | C2150-810 questions and answers | CCB-400 study guide | 156-815 mock test | M8010-246 real questions |



C2040-421 dumps | C2090-730 test prep | 1Z0-202 practice test | 200-601 braindumps | 250-521 questions and answers | ACE test prep | C9050-041 dumps questions | AND-402 Practice test | AEMT test prep | JN0-201 braindumps | 1Z0-926 Practice Test | HP0-Y30 demo test | C2020-612 dump | 70-775 test prep | SCP-500 VCE | HP2-E43 real questions | 642-654 real questions | ADM-211 test questions | MB2-707 pdf download | DEA-64T1 practice questions |


View Complete list of Killexams.com Certification test dumps


HP0-Y47 test prep | 3M0-300 study guide | LOT-409 questions and answers | VCS-409 cheat sheets | 300-375 free pdf | 304-200 examcollection | EX300 practice test | P3OF real questions | HP0-620 free pdf download | 70-743 cram | 000-288 demo test | NBCC-NCC Practice Test | 00M-651 dumps | HP0-J21 test questions | CISA real questions | 000-286 dump | 000-422 braindumps | COG-135 test prep | CPA-AUD mock test | HP2-Z07 study guide |



List of Certification test Dumps

3COM [8 Certification Exam(s) ]
AccessData [1 Certification Exam(s) ]
ACFE [1 Certification Exam(s) ]
ACI [3 Certification Exam(s) ]
Acme-Packet [1 Certification Exam(s) ]
ACSM [4 Certification Exam(s) ]
ACT [1 Certification Exam(s) ]
Admission-Tests [13 Certification Exam(s) ]
ADOBE [93 Certification Exam(s) ]
AFP [1 Certification Exam(s) ]
AICPA [2 Certification Exam(s) ]
AIIM [1 Certification Exam(s) ]
Alcatel-Lucent [13 Certification Exam(s) ]
Alfresco [1 Certification Exam(s) ]
Altiris [3 Certification Exam(s) ]
Amazon [7 Certification Exam(s) ]
American-College [2 Certification Exam(s) ]
Android [4 Certification Exam(s) ]
APA [1 Certification Exam(s) ]
APC [2 Certification Exam(s) ]
APICS [2 Certification Exam(s) ]
Apple [71 Certification Exam(s) ]
AppSense [1 Certification Exam(s) ]
APTUSC [1 Certification Exam(s) ]
Arizona-Education [1 Certification Exam(s) ]
ARM [1 Certification Exam(s) ]
Aruba [8 Certification Exam(s) ]
ASIS [2 Certification Exam(s) ]
ASQ [3 Certification Exam(s) ]
ASTQB [8 Certification Exam(s) ]
Autodesk [2 Certification Exam(s) ]
Avaya [106 Certification Exam(s) ]
AXELOS [1 Certification Exam(s) ]
Axis [1 Certification Exam(s) ]
Banking [1 Certification Exam(s) ]
BEA [5 Certification Exam(s) ]
BICSI [2 Certification Exam(s) ]
BlackBerry [17 Certification Exam(s) ]
BlueCoat [2 Certification Exam(s) ]
Brocade [4 Certification Exam(s) ]
Business-Objects [11 Certification Exam(s) ]
Business-Tests [4 Certification Exam(s) ]
CA-Technologies [20 Certification Exam(s) ]
Certification-Board [10 Certification Exam(s) ]
Certiport [3 Certification Exam(s) ]
CheckPoint [44 Certification Exam(s) ]
CIDQ [1 Certification Exam(s) ]
CIPS [4 Certification Exam(s) ]
Cisco [321 Certification Exam(s) ]
Citrix [48 Certification Exam(s) ]
CIW [18 Certification Exam(s) ]
Cloudera [10 Certification Exam(s) ]
Cognos [19 Certification Exam(s) ]
College-Board [2 Certification Exam(s) ]
CompTIA [79 Certification Exam(s) ]
ComputerAssociates [6 Certification Exam(s) ]
Consultant [2 Certification Exam(s) ]
Counselor [4 Certification Exam(s) ]
CPP-Institute [4 Certification Exam(s) ]
CSP [1 Certification Exam(s) ]
CWNA [1 Certification Exam(s) ]
CWNP [14 Certification Exam(s) ]
CyberArk [2 Certification Exam(s) ]
Dassault [2 Certification Exam(s) ]
DELL [13 Certification Exam(s) ]
DMI [1 Certification Exam(s) ]
DRI [1 Certification Exam(s) ]
ECCouncil [23 Certification Exam(s) ]
ECDL [1 Certification Exam(s) ]
EMC [128 Certification Exam(s) ]
Enterasys [13 Certification Exam(s) ]
Ericsson [5 Certification Exam(s) ]
ESPA [1 Certification Exam(s) ]
Esri [2 Certification Exam(s) ]
ExamExpress [15 Certification Exam(s) ]
Exin [40 Certification Exam(s) ]
ExtremeNetworks [3 Certification Exam(s) ]
F5-Networks [20 Certification Exam(s) ]
FCTC [2 Certification Exam(s) ]
Filemaker [9 Certification Exam(s) ]
Financial [36 Certification Exam(s) ]
Food [4 Certification Exam(s) ]
Fortinet [16 Certification Exam(s) ]
Foundry [6 Certification Exam(s) ]
FSMTB [1 Certification Exam(s) ]
Fujitsu [2 Certification Exam(s) ]
GAQM [9 Certification Exam(s) ]
Genesys [4 Certification Exam(s) ]
GIAC [15 Certification Exam(s) ]
Google [5 Certification Exam(s) ]
GuidanceSoftware [2 Certification Exam(s) ]
H3C [1 Certification Exam(s) ]
HDI [9 Certification Exam(s) ]
Healthcare [3 Certification Exam(s) ]
HIPAA [2 Certification Exam(s) ]
Hitachi [30 Certification Exam(s) ]
Hortonworks [4 Certification Exam(s) ]
Hospitality [2 Certification Exam(s) ]
HP [753 Certification Exam(s) ]
HR [4 Certification Exam(s) ]
HRCI [1 Certification Exam(s) ]
Huawei [31 Certification Exam(s) ]
Hyperion [10 Certification Exam(s) ]
IAAP [1 Certification Exam(s) ]
IAHCSMM [1 Certification Exam(s) ]
IBM [1535 Certification Exam(s) ]
IBQH [1 Certification Exam(s) ]
ICAI [1 Certification Exam(s) ]
ICDL [6 Certification Exam(s) ]
IEEE [1 Certification Exam(s) ]
IELTS [1 Certification Exam(s) ]
IFPUG [1 Certification Exam(s) ]
IIA [3 Certification Exam(s) ]
IIBA [2 Certification Exam(s) ]
IISFA [1 Certification Exam(s) ]
Intel [2 Certification Exam(s) ]
IQN [1 Certification Exam(s) ]
IRS [1 Certification Exam(s) ]
ISA [1 Certification Exam(s) ]
ISACA [4 Certification Exam(s) ]
ISC2 [6 Certification Exam(s) ]
ISEB [24 Certification Exam(s) ]
Isilon [4 Certification Exam(s) ]
ISM [6 Certification Exam(s) ]
iSQI [7 Certification Exam(s) ]
ITEC [1 Certification Exam(s) ]
Juniper [66 Certification Exam(s) ]
LEED [1 Certification Exam(s) ]
Legato [5 Certification Exam(s) ]
Liferay [1 Certification Exam(s) ]
Logical-Operations [1 Certification Exam(s) ]
Lotus [66 Certification Exam(s) ]
LPI [24 Certification Exam(s) ]
LSI [3 Certification Exam(s) ]
Magento [3 Certification Exam(s) ]
Maintenance [2 Certification Exam(s) ]
McAfee [9 Certification Exam(s) ]
McData [3 Certification Exam(s) ]
Medical [68 Certification Exam(s) ]
Microsoft [387 Certification Exam(s) ]
Mile2 [3 Certification Exam(s) ]
Military [1 Certification Exam(s) ]
Misc [1 Certification Exam(s) ]
Motorola [7 Certification Exam(s) ]
mySQL [4 Certification Exam(s) ]
NBSTSA [1 Certification Exam(s) ]
NCEES [2 Certification Exam(s) ]
NCIDQ [1 Certification Exam(s) ]
NCLEX [3 Certification Exam(s) ]
Network-General [12 Certification Exam(s) ]
NetworkAppliance [39 Certification Exam(s) ]
NI [1 Certification Exam(s) ]
NIELIT [1 Certification Exam(s) ]
Nokia [6 Certification Exam(s) ]
Nortel [130 Certification Exam(s) ]
Novell [37 Certification Exam(s) ]
OMG [10 Certification Exam(s) ]
Oracle [299 Certification Exam(s) ]
P&C [2 Certification Exam(s) ]
Palo-Alto [4 Certification Exam(s) ]
PARCC [1 Certification Exam(s) ]
PayPal [1 Certification Exam(s) ]
Pegasystems [12 Certification Exam(s) ]
PEOPLECERT [4 Certification Exam(s) ]
PMI [16 Certification Exam(s) ]
Polycom [2 Certification Exam(s) ]
PostgreSQL-CE [1 Certification Exam(s) ]
Prince2 [7 Certification Exam(s) ]
PRMIA [1 Certification Exam(s) ]
PsychCorp [1 Certification Exam(s) ]
PTCB [2 Certification Exam(s) ]
QAI [1 Certification Exam(s) ]
QlikView [1 Certification Exam(s) ]
Quality-Assurance [7 Certification Exam(s) ]
RACC [1 Certification Exam(s) ]
Real Estate [1 Certification Exam(s) ]
Real-Estate [1 Certification Exam(s) ]
RedHat [8 Certification Exam(s) ]
RES [5 Certification Exam(s) ]
Riverbed [8 Certification Exam(s) ]
RSA [15 Certification Exam(s) ]
Sair [8 Certification Exam(s) ]
Salesforce [5 Certification Exam(s) ]
SANS [1 Certification Exam(s) ]
SAP [98 Certification Exam(s) ]
SASInstitute [15 Certification Exam(s) ]
SAT [1 Certification Exam(s) ]
SCO [10 Certification Exam(s) ]
SCP [6 Certification Exam(s) ]
SDI [3 Certification Exam(s) ]
See-Beyond [1 Certification Exam(s) ]
Siemens [1 Certification Exam(s) ]
Snia [7 Certification Exam(s) ]
SOA [15 Certification Exam(s) ]
Social-Work-Board [4 Certification Exam(s) ]
SpringSource [1 Certification Exam(s) ]
SUN [63 Certification Exam(s) ]
SUSE [1 Certification Exam(s) ]
Sybase [17 Certification Exam(s) ]
Symantec [136 Certification Exam(s) ]
Teacher-Certification [4 Certification Exam(s) ]
The-Open-Group [8 Certification Exam(s) ]
TIA [3 Certification Exam(s) ]
Tibco [18 Certification Exam(s) ]
Trainers [3 Certification Exam(s) ]
Trend [1 Certification Exam(s) ]
TruSecure [1 Certification Exam(s) ]
USMLE [1 Certification Exam(s) ]
VCE [7 Certification Exam(s) ]
Veeam [2 Certification Exam(s) ]
Veritas [33 Certification Exam(s) ]
Vmware [63 Certification Exam(s) ]
Wonderlic [2 Certification Exam(s) ]
Worldatwork [2 Certification Exam(s) ]
XML-Master [3 Certification Exam(s) ]
Zend [6 Certification Exam(s) ]





References :


Dropmark : http://killexams.dropmark.com/367904/11576124
Wordpress : http://wp.me/p7SJ6L-Jc
Issu : https://issuu.com/trutrainers/docs/920-174
Dropmark-Text : http://killexams.dropmark.com/367904/12094634
Blogspot : http://killexams-braindumps.blogspot.com/2017/11/ensure-your-success-with-this-920-174.html
RSS Feed : http://feeds.feedburner.com/JustStudyTheseNortel920-174QuestionsAndPassTheRealTest
weSRCH : https://www.wesrch.com/business/prpdfBU1HWO000KWCH
Youtube : https://youtu.be/sT11vi1zuJA
Google+ : https://plus.google.com/112153555852933435691/posts/Fih1JjTvFmk?hl=en
publitas.com : https://view.publitas.com/trutrainers-inc/pass4sure-920-174-real-question-bank
Calameo : http://en.calameo.com/books/0049235266b7cede9f7f8
Box.net : https://app.box.com/s/a926c3amyyibr06qlay9gszaevipzx3r
zoho.com : https://docs.zoho.com/file/5pm6x997ea9d05c05440faa5714cf91218b3d
MegaCerts.com Certification test dumps






View Complete PDF »

We Make Sure Q&A work for you!

 

Pass4sure PDFs (Pass4sure Questions and Answers), Viewable at all devices like PC Windows (all versions), Linux (All versions), Mac / iOS (iPhone/iPad and all other devices), Android (All versions). It support High Quality Printable book format. You can print and carry anywhere with you, as you like.

Testing and Training Engine Software (Pass4sure VCE Practice Test) Compatible with All Windows PC (Windows 10/9/8/7/Vista/XP/2000/98 etc). Mac (Through Wine, Virtual Windows PC, Dual boot). It prepares your test for all the topics of exam, gives you exam tips and tricks by asking tricky questions, uses latest practice quiz to train you for the real test taking experience in learning mode as well as real test mode. Provides performance graphs and training history etc.

 

More Useful Links about 920-174

 

Information Links



References:


920-174 brain dump | 920-174 bootcamp | 920-174 real questions | 920-174 practical test | 920-174 practice questions | 920-174 test prep | 920-174 study material | 920-174 exam prep | 920-174 study guide | 920-174 online exam | 920-174 training material | 920-174 mock test | 920-174 mock exam | 920-174 free practice tests | 920-174 free test | 920-174 test answers | 920-174 online test | 920-174 test questions | 920-174 exam questions | 920-174 exam papers | 920-174 assessment test sample | 920-174 reading practice test | 920-174 practice test | 920-174 test questions | 920-174 exam prep | 920-174 online exam | 920-174 free prep | 920-174 exam answers | 920-174 sample test questions | 920-174 test exam | 920-174 exam results | 920-174 free exam papers | 920-174 exam dumps | 920-174 past bar exams | 920-174 exam preparation | 920-174 free online test | 920-174 practice exam | 920-174 test questions and answers | 920-174 exam test | 920-174 test sample | 920-174 sample test | 920-174 test practice | 920-174 free test online | 920-174 question test | 920-174 model question | 920-174 exam tips | 920-174 certification sample | 920-174 pass exam | 920-174 prep questions | 920-174 entrance exam | 920-174 essay questions | 920-174 sample questions | 920-174 study questions | 920-174 mock questions | 920-174 test example | 920-174 past exams | 920-174 quest bars

 

 

Services Overview

We provide Pass4sure Questions and Answers and exam simulators for the candidates to prepare their exam and pass at first attempt.

Contact Us

As a team are working hard to provide the candidates best study material with proper guideline to face the real exam.

Address: 15th floor, 7# building 16 Xi Si Huan.
Telephone: +86 10 88227272
FAX: +86 10 68179899
Others: +301 - 0125 - 01258



   

   

 

 



.
 

  .